CRTAP Antikörper (N-Term)

Produktnummer ABIN635556

Dieses Anti-CRTAP-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CRTAP in WB. Geeignet für Human.

Kurzübersicht für CRTAP Antikörper (N-Term) (ABIN635556)

Target: CRTAP (Cartilage Associated Protein (CRTAP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRTAP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CRTAP Antikörper

Bindungsspezifität: N-Term

Spezifität: CRTAP antibody was raised against the N terminal of CRTAP

Aufreinigung: Affinity purified

Immunogen: CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CRTAP Blocking Peptide, (ABIN5613008), is also available for use as a blocking control in assays to test for specificity of this CRTAP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRTAP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRTAP

Target: CRTAP (Cartilage Associated Protein (CRTAP))

Andere Bezeichnung: CRTAP

Hintergrund: The protein encoded by this gene is similar to the chicken and mouse CRTAP genes. The encoded protein is a scaffolding protein that may influence the activity of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli.

Molekulargewicht: 44 kDa (MW of target protein)