SC5DL Antikörper
-
- Target Alle SC5DL Antikörper anzeigen
- SC5DL (Sterol-C5-Desaturase (SC5DL))
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SC5DL Antikörper ist unkonjugiert
- Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SC5 DL antibody was raised using a synthetic peptide corresponding to a region with amino acids NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SC5DL Blocking Peptide, catalog no. 33R-6850, is also available for use as a blocking control in assays to test for specificity of this SC5DL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SC0 L antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SC5DL (Sterol-C5-Desaturase (SC5DL))
- Andere Bezeichnung
- SC5DL (SC5DL Produkte)
- Hintergrund
- This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described.
- Molekulargewicht
- 35 kDa (MW of target protein)
-