OCA2 Antikörper (Middle Region)

Produktnummer ABIN635550

Produktdetails anti-OCA2 Antikörper

Target: OCA2 (P Protein (OCA2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OCA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OCA2 antibody was raised against the middle region of OCA2

Aufreinigung: Affinity purified

Immunogen: OCA2 antibody was raised using the middle region of OCA2 corresponding to a region with amino acids LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OCA2 Blocking Peptide, catalog no. 33R-5036, is also available for use as a blocking control in assays to test for specificity of this OCA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-OCA2 Antikörper (ABIN635550)

Jeffery: "Distal Regeneration Involves the Age Dependent Activity of Branchial Sac Stem Cells in the Ascidian Ciona intestinalis." in: Regeneration (Oxford, England), Vol. 2, Issue 1, pp. 1-18, (2015) (PubMed).

Details zu OCA2

Target: OCA2 (P Protein (OCA2))

Andere Bezeichnung: OCA2 (OCA2 Produkte)

Synonyme: D7H15S12 antikoerper, D7Icr28RN antikoerper, D7Nic1 antikoerper, p antikoerper, BEY antikoerper, BEY1 antikoerper, BEY2 antikoerper, BOCA antikoerper, D15S12 antikoerper, EYCL antikoerper, EYCL2 antikoerper, EYCL3 antikoerper, HCL3 antikoerper, P antikoerper, PED antikoerper, SHEP1 antikoerper, OCA2 antikoerper, P protein antikoerper, oculocutaneous albinism II antikoerper, OCA2 melanosomal transmembrane protein antikoerper, P antikoerper, p antikoerper, Oca2 antikoerper, OCA2 antikoerper, oca2 antikoerper

Substanzklasse: Viral Protein

Hintergrund: This gene encodes the human homologue of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin. Mutations in this gene result in type 2 oculocutaneous albinism.

Molekulargewicht: 93 kDa (MW of target protein)