PEX10 Antikörper (C-Term)

Produktnummer ABIN635547

Dieses Anti-PEX10-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PEX10 in WB. Geeignet für Human.

Kurzübersicht für PEX10 Antikörper (C-Term) (ABIN635547)

Target: PEX10 (Peroxisomal Biogenesis Factor 10 (PEX10))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PEX10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PEX10 Antikörper

Bindungsspezifität: C-Term

Spezifität: PEX10 antibody was raised against the C terminal of PEX10

Aufreinigung: Affinity purified

Immunogen: PEX10 antibody was raised using the C terminal of PEX10 corresponding to a region with amino acids ERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PEX10 Blocking Peptide, (ABIN938098), is also available for use as a blocking control in assays to test for specificity of this PEX10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PEX10

Target: PEX10 (Peroxisomal Biogenesis Factor 10 (PEX10))

Andere Bezeichnung: PEX10

Hintergrund: PEX10 is a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in PEX10 gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process