AWAT2 Antikörper (C-Term)

Produktnummer ABIN635543

Produktdetails anti-AWAT2 Antikörper

Target: AWAT2 (Acyl-CoA Wax Alcohol Acyltransferase 2 (AWAT2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AWAT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DGAT2 L4 antibody was raised against the C terminal of DGAT2 4

Aufreinigung: Affinity purified

Immunogen: DGAT2 L4 antibody was raised using the C terminal of DGAT2 4 corresponding to a region with amino acids GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DGAT2L4 Blocking Peptide, catalog no. 33R-3242, is also available for use as a blocking control in assays to test for specificity of this DGAT2L4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGAT0 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AWAT2

Target: AWAT2 (Acyl-CoA Wax Alcohol Acyltransferase 2 (AWAT2))

Andere Bezeichnung: DGAT2L4 (AWAT2 Produkte)

Synonyme: DGAT2L4 antikoerper, ARAT antikoerper, DC4 antikoerper, MFAT antikoerper, WS antikoerper, 9430062J17Rik antikoerper, Dgat2l4 antikoerper, RGD1565111 antikoerper, acyl-CoA wax alcohol acyltransferase 2 antikoerper, AWAT2 antikoerper, Awat2 antikoerper

Hintergrund: DGAT2L4 is acyltransferase that predominantly esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that it plays a central role in lipid metabolism in skin. It has no activity using decyl alcohol and significantly prefers the C16 and C18 alcohols.

Molekulargewicht: 38 kDa (MW of target protein)