GOLGA5 Antikörper (N-Term)
-
- Target Alle GOLGA5 Antikörper anzeigen
- GOLGA5 (Golgin A5 (GOLGA5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GOLGA5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GOLGA5 antibody was raised against the N terminal of GOLGA5
- Aufreinigung
- Affinity purified
- Immunogen
- GOLGA5 antibody was raised using the N terminal of GOLGA5 corresponding to a region with amino acids FVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVS
- Top Product
- Discover our top product GOLGA5 Primärantikörper
-
anti-Golgin A5 (GOLGA5) antibody
GOLGA5 Reaktivität: Human WB, IF, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Golgin A5 (GOLGA5) (AA 1-731) antibodyGOLGA5 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Golgin A5 (GOLGA5) (AA 2-99) antibodyGOLGA5 Reaktivität: Human WB, ELISA, RNAi Wirt: Maus Monoclonal 6B3 unconjugated
anti-Golgin A5 (GOLGA5) (AA 1-731) antibodyGOLGA5 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Golgin A5 (GOLGA5) (AA 1-300) antibodyGOLGA5 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Golgin A5 (GOLGA5) (AA 510-713) antibodyGOLGA5 Reaktivität: Human, Hund WB, IF Wirt: Maus Monoclonal 26-Golgin unconjugated
anti-Golgin A5 (GOLGA5) (AA 1-300) antibodyGOLGA5 Reaktivität: Human WB Wirt: Maus Monoclonal 1720CT766-40-46 unconjugated
anti-Golgin A5 (GOLGA5) (AA 110-159) antibodyGOLGA5 Reaktivität: Human, Maus, Ratte, Affe, Meerschweinchen, Fledermaus, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
anti-Golgin A5 (GOLGA5) (N-Term) antibodyGOLGA5 Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Rind (Kuh), Pferd, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GOLGA5 Blocking Peptide, catalog no. 33R-3120, is also available for use as a blocking control in assays to test for specificity of this GOLGA5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLGA5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GOLGA5 (Golgin A5 (GOLGA5))
- Andere Bezeichnung
- GOLGA5 (GOLGA5 Produkte)
- Synonyme
- GOLIM5 antikoerper, RFG5 antikoerper, ret-II antikoerper, golim5 antikoerper, ret-ii antikoerper, rfg5 antikoerper, Ret-II antikoerper, im:7153094 antikoerper, sb:cb898 antikoerper, wu:fd50h11 antikoerper, zgc:66400 antikoerper, golgin A5 antikoerper, golgin A5 L homeolog antikoerper, golgi autoantigen, golgin subfamily a, 5 antikoerper, GOLGA5 antikoerper, golga5.L antikoerper, golga5 antikoerper, Golga5 antikoerper
- Hintergrund
- GOLGA5 is a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues.
- Molekulargewicht
- 83 kDa (MW of target protein)
-
