MUC1 Antikörper (C-Term)

Produktnummer ABIN635541

Dieses Anti-MUC1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von MUC1 in IHC und WB. Geeignet für Human, Maus und Hund.

Kurzübersicht für MUC1 Antikörper (C-Term) (ABIN635541)

Target: MUC1 (Mucin 1 (MUC1))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MUC1 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Produktdetails anti-MUC1 Antikörper

Bindungsspezifität: C-Term

Spezifität: MUC1 antibody was raised against the C terminal of MUC1

Aufreinigung: Affinity purified

Immunogen: MUC1 antibody was raised using the C terminal of MUC1 corresponding to a region with amino acids GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MUC1 Blocking Peptide, (ABIN938886), is also available for use as a blocking control in assays to test for specificity of this MUC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MUC1

Target: MUC1 (Mucin 1 (MUC1))

Andere Bezeichnung: MUC1

Hintergrund: MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Negative Regulation of intrinsic apoptotic Signaling