Reticulon 1 Antikörper (N-Term)

Produktnummer ABIN635538

Dieses Anti-Reticulon 1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Reticulon 1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für Reticulon 1 Antikörper (N-Term) (ABIN635538)

Target: Reticulon 1 (RTN1)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Reticulon 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Reticulon 1 Antikörper

Bindungsspezifität: N-Term

Spezifität: RTN1 antibody was raised against the N terminal of RTN1

Aufreinigung: Affinity purified

Immunogen: RTN1 antibody was raised using the N terminal of RTN1 corresponding to a region with amino acids EEREAELDSELIIESCDASSASEESPKREQDSPPMKPSALDAIREETGVR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RTN1 Blocking Peptide, (ABIN937770), is also available for use as a blocking control in assays to test for specificity of this RTN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Reticulon 1

Target: Reticulon 1 (RTN1)

Andere Bezeichnung: RTN1

Hintergrund: Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.

Molekulargewicht: 39 kDa (MW of target protein)