UST Antikörper (N-Term)

Produktnummer ABIN635536

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch UST in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für UST Antikörper (N-Term) (ABIN635536)

Target: UST (Uronyl-2-Sulfotransferase (UST))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UST Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UST Antikörper

Bindungsspezifität: N-Term

Spezifität: UST antibody was raised against the N terminal of UST

Aufreinigung: Affinity purified

Immunogen: UST antibody was raised using the N terminal of UST corresponding to a region with amino acids PPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UST Blocking Peptide, (ABIN5616940), is also available for use as a blocking control in assays to test for specificity of this UST antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UST antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UST

Target: UST (Uronyl-2-Sulfotransferase (UST))

Andere Bezeichnung: UST

Hintergrund: UST catalyzes the transfer of sulfate to the position 2 of uronyl residues. UST has mainly activity toward iduronyl residues in dermatan sulfate, and weaker activity toward glucuronyl residues of chondroitin sulfate. It has no activity toward desulfated N-resulfated heparin.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process