WDR33 Antikörper (N-Term)

Produktnummer ABIN635525

Der Kaninchen Polyklonal Anti-WDR33-Antikörper wurde für WB validiert. Er ist geeignet, WDR33 in Proben von Human zu detektieren.

Kurzübersicht für WDR33 Antikörper (N-Term) (ABIN635525)

Target: WDR33 (WD Repeat Domain 33 (WDR33))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR33 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-WDR33 Antikörper

Bindungsspezifität: N-Term

Spezifität: WDR33 antibody was raised against the N terminal of WDR33

Aufreinigung: Affinity purified

Immunogen: WDR33 antibody was raised using the N terminal of WDR33 corresponding to a region with amino acids IWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR33 Blocking Peptide, (ABIN939600), is also available for use as a blocking control in assays to test for specificity of this WDR33 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR33 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR33

Target: WDR33 (WD Repeat Domain 33 (WDR33))

Andere Bezeichnung: WDR33

Hintergrund: WDR33 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

Molekulargewicht: 38 kDa (MW of target protein)