ERVW-1 Antikörper (N-Term)

Produktnummer ABIN635520

Dieses Anti-ERVW-1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ERVW-1 in WB. Geeignet für Human.

Kurzübersicht für ERVW-1 Antikörper (N-Term) (ABIN635520)

Target: ERVW-1 (Endogenous Retrovirus Group W, Member 1 (ERVW-1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERVW-1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ERVW-1 Antikörper

Bindungsspezifität: N-Term

Spezifität: ERVWE1 antibody was raised against the N terminal of ERVWE1

Aufreinigung: Affinity purified

Immunogen: ERVWE1 antibody was raised using the N terminal of ERVWE1 corresponding to a region with amino acids TQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ERVWE1 Blocking Peptide, (ABIN5613401), is also available for use as a blocking control in assays to test for specificity of this ERVWE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERVWE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERVW-1

Target: ERVW-1 (Endogenous Retrovirus Group W, Member 1 (ERVW-1))

Andere Bezeichnung: ERVWE1

Hintergrund: ERVWE1 or syncytin, is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Molekulargewicht: 24 kDa (MW of target protein)