ACSL1 Antikörper (C-Term)
-
- Target Alle ACSL1 (Acsl1) Antikörper anzeigen
- ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACSL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- ACSL1 antibody was raised against the C terminal of ACSL1
- Aufreinigung
- Affinity purified
- Immunogen
- ACSL1 antibody was raised using the C terminal of ACSL1 corresponding to a region with amino acids GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG
- Top Product
- Discover our top product Acsl1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACSL1 Blocking Peptide, catalog no. 33R-3560, is also available for use as a blocking control in assays to test for specificity of this ACSL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))
- Andere Bezeichnung
- ACSL1 (Acsl1 Produkte)
- Synonyme
- ACS1 antikoerper, FACL1 antikoerper, FACL2 antikoerper, LACS antikoerper, LACS1 antikoerper, LACS2 antikoerper, Acas antikoerper, Acas1 antikoerper, Acs antikoerper, FACS antikoerper, Facl2 antikoerper, ACS antikoerper, COAA antikoerper, zgc:110081 antikoerper, CER8 antikoerper, ECERIFERUM 8 antikoerper, LONG-CHAIN ACYL-COA SYNTHASE 1 antikoerper, T8I13.8 antikoerper, F13F21.14 antikoerper, F13F21_14 antikoerper, LATERAL ROOT DEVELOPMENT 2 antikoerper, LRD2 antikoerper, long-chain acyl-CoA synthetase 2 antikoerper, acyl-CoA synthetase long chain family member 1 antikoerper, acyl-CoA synthetase long-chain family member 1 antikoerper, acyl-CoA synthetase long chain family member 1a antikoerper, AMP-dependent synthetase and ligase family protein antikoerper, long-chain acyl-CoA synthetase 2 antikoerper, ACSL1 antikoerper, Acsl1 antikoerper, acsl1a antikoerper, LACS1 antikoerper, LACS2 antikoerper
- Hintergrund
- ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.
- Molekulargewicht
- 78 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-