PON3 Antikörper (Middle Region)
-
- Target Alle PON3 Antikörper anzeigen
- PON3 (Paraoxonase 3 (PON3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PON3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PON3 antibody was raised against the middle region of PON3
- Aufreinigung
- Affinity purified
- Immunogen
- PON3 antibody was raised using the middle region of PON3 corresponding to a region with amino acids FKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYATRDHYFTNSLLSF
- Top Product
- Discover our top product PON3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PON3 Blocking Peptide, catalog no. 33R-2947, is also available for use as a blocking control in assays to test for specificity of this PON3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PON3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PON3 (Paraoxonase 3 (PON3))
- Andere Bezeichnung
- PON3 (PON3 Produkte)
- Synonyme
- 2810004E20 antikoerper, AI786302 antikoerper, paraoxonase 3 antikoerper, PON3 antikoerper, Pon3 antikoerper
- Hintergrund
- This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL).
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-