PON3 Antikörper (Middle Region)

Produktnummer ABIN635503

Produktdetails anti-PON3 Antikörper

Target: PON3 (Paraoxonase 3 (PON3))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PON3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PON3 antibody was raised against the middle region of PON3

Aufreinigung: Affinity purified

Immunogen: PON3 antibody was raised using the middle region of PON3 corresponding to a region with amino acids FKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYATRDHYFTNSLLSF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PON3 Blocking Peptide, catalog no. 33R-2947, is also available for use as a blocking control in assays to test for specificity of this PON3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PON3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PON3

Target: PON3 (Paraoxonase 3 (PON3))

Andere Bezeichnung: PON3 (PON3 Produkte)

Synonyme: 2810004E20 antikoerper, AI786302 antikoerper, paraoxonase 3 antikoerper, PON3 antikoerper, Pon3 antikoerper

Hintergrund: This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL).

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process