Sphingomyelin Synthase 2 Antikörper (SGMS2) (N-Term)

Details for Product anti-SGMS2 Antibody No. ABIN635499
Antigen
Epitop
N-Term
20
19
9
4
3
2
2
1
Reaktivität
Human, Maus, Ratte (Rattus)
58
19
7
4
4
4
4
4
2
2
2
2
2
Wirt
Kaninchen
55
3
Klonalität
Polyklonal
Konjugat
Dieser Sphingomyelin Synthase 2 Antikörper ist unkonjugiert
5
5
5
4
4
4
Applikation
Western Blotting (WB)
52
39
17
17
4
3
1
1
Optionen
Immunogen SGMS2 antibody was raised using the N terminal of SGMS2 corresponding to a region with amino acids KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY
Spezifität SGMS2 antibody was raised against the N terminal of SGMS2
Reinigung Affinity purified
Antigen
Andere Bezeichnung SGMS2 (SGMS2 Antibody Abstract)
Hintergrund SGMS2 is a bidirectional lipid cholinephosphotransferase capable of converting phosphatidylcholine (PC) and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. Direction is dependent on the relative concentrations of DAG and ceramide as phosphocholine acceptors. SGMS2 directly and specifically recognises the choline head group on the substrate. SGMS2 also requires two fatty chains on the choline-P donor molecule in order to be recognised efficiently as a substrate. SGMS2 does not function strictly as a SM synthase.
Molekulargewicht 42 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SGMS2 Blocking Peptide, catalog no. 33R-4378, is also available for use as a blocking control in assays to test for specificity of this SGMS2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGMS2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Sphingomyelin Synthase 2 (SGMS2) (N-Term) antibody (ABIN635499) SGMS2 antibody used at 1 ug/ml to detect target protein.