TMEM132B Antikörper (Middle Region)

Produktnummer ABIN635495

Produktdetails anti-TMEM132B Antikörper

Target: TMEM132B (Transmembrane Protein 132B (TMEM132B))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM132B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM132 B antibody was raised against the middle region of TMEM132

Aufreinigung: Affinity purified

Immunogen: TMEM132 B antibody was raised using the middle region of TMEM132 corresponding to a region with amino acids VQEWFHRGTPVGQEESTNKSTTPQSPMEGKNKLLKSGGPDAFTSFPTQGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM132B Blocking Peptide, catalog no. 33R-9746, is also available for use as a blocking control in assays to test for specificity of this TMEM132B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM130 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM132B

Target: TMEM132B (Transmembrane Protein 132B (TMEM132B))

Andere Bezeichnung: TMEM132B (TMEM132B Produkte)

Synonyme: RGD1566191 antikoerper, AK220418 antikoerper, mKIAA1786 antikoerper, transmembrane protein 132B antikoerper, Tmem132b antikoerper, TMEM132B antikoerper, tmem132b antikoerper, LOC100556911 antikoerper, LOC100606383 antikoerper

Hintergrund: TMEM132B single-pass type I membrane protein. It belongs to the TMEM132 family. The exact function of TMEM132B is not known.

Molekulargewicht: 119 kDa (MW of target protein)