RNFT2 Antikörper (Ring Finger Protein, Transmembrane 2) (N-Term)

Details for Product anti-RNFT2 Antibody No. ABIN635491
Antigen
Epitop
N-Term
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
4
3
3
2
2
2
2
2
2
1
1
Wirt
Kaninchen
4
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
4
2
Optionen
Immunogen TMEM118 antibody was raised using the N terminal Of Tmem118 corresponding to a region with amino acids HGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGL
Spezifität TMEM118 antibody was raised against the N terminal Of Tmem118
Reinigung Affinity purified
Antigen
Andere Bezeichnung TMEM118
Hintergrund TMEM118 is a multi-pass membrane protein, and contains 1 RING-type zinc finger. The function of TMEM118 remains unknown.
Molekulargewicht 46 kDa (MW of target protein)
Applikations-hinweise WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

TMEM118 Blocking Peptide, catalog no. 33R-3736, is also available for use as a blocking control in assays to test for specificity of this TMEM118 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM118 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Ring Finger Protein, Transmembrane 2 (RNFT2) (N-Term) antibody (ABIN635491) TMEM118 antibody used at 0.5 ug/ml to detect target protein.