TSPAN10 Antikörper (N-Term)

Produktnummer ABIN635489

Produktdetails anti-TSPAN10 Antikörper

Target: TSPAN10 (Tetraspanin 10 (TSPAN10))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSPAN10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Tetraspanin 10 antibody was raised against the N terminal of TSPAN10

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 10 antibody was raised using the N terminal of TSPAN10 corresponding to a region with amino acids SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 10 Blocking Peptide, catalog no. 33R-8345, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSPAN10

Target: TSPAN10 (Tetraspanin 10 (TSPAN10))

Andere Bezeichnung: Tetraspanin 10 (TSPAN10 Produkte)

Synonyme: GB13074 antikoerper, OCSP antikoerper, Ocsp antikoerper, tetraspanin 10 antikoerper, tetraspanin-10 antikoerper, Tspan10 antikoerper, TSPAN10 antikoerper, LOC483364 antikoerper

Hintergrund: TSPAN10 belongs to the tetraspanin (TM4SF) family. It is a multi-pass membrane protein. The exact function of TSPAN10 remains unknown.

Molekulargewicht: 37 kDa (MW of target protein)