TSPAN10 Antikörper (N-Term)
-
- Target Alle TSPAN10 Produkte
- TSPAN10 (Tetraspanin 10 (TSPAN10))
- Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TSPAN10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Tetraspanin 10 antibody was raised against the N terminal of TSPAN10
- Aufreinigung
- Affinity purified
- Immunogen
- Tetraspanin 10 antibody was raised using the N terminal of TSPAN10 corresponding to a region with amino acids SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLG
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Tetraspanin 10 Blocking Peptide, catalog no. 33R-8345, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TSPAN10 (Tetraspanin 10 (TSPAN10))
- Andere Bezeichnung
- Tetraspanin 10 (TSPAN10 Produkte)
- Hintergrund
- TSPAN10 belongs to the tetraspanin (TM4SF) family. It is a multi-pass membrane protein. The exact function of TSPAN10 remains unknown.
- Molekulargewicht
- 37 kDa (MW of target protein)
-