TSPAN10 Antikörper (N-Term)

Produktnummer ABIN635489

Der Kaninchen Polyklonal Anti-TSPAN10-Antikörper wurde für WB validiert. Er ist geeignet, TSPAN10 in Proben von Human zu detektieren.

Kurzübersicht für TSPAN10 Antikörper (N-Term) (ABIN635489)

Target: TSPAN10 (Tetraspanin 10 (TSPAN10))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSPAN10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TSPAN10 Antikörper

Bindungsspezifität: N-Term

Spezifität: Tetraspanin 10 antibody was raised against the N terminal of TSPAN10

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 10 antibody was raised using the N terminal of TSPAN10 corresponding to a region with amino acids SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 10 Blocking Peptide, (ABIN5616556), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSPAN10

Target: TSPAN10 (Tetraspanin 10 (TSPAN10))

Andere Bezeichnung: Tetraspanin 10

Hintergrund: TSPAN10 belongs to the tetraspanin (TM4SF) family. It is a multi-pass membrane protein. The exact function of TSPAN10 remains unknown.

Molekulargewicht: 37 kDa (MW of target protein)