TSPAN10 Antikörper (N-Term)
Kurzübersicht für TSPAN10 Antikörper (N-Term) (ABIN635489)
Target
Reaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- Tetraspanin 10 antibody was raised against the N terminal of TSPAN10
-
Aufreinigung
- Affinity purified
-
Immunogen
- Tetraspanin 10 antibody was raised using the N terminal of TSPAN10 corresponding to a region with amino acids SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLG
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
Tetraspanin 10 Blocking Peptide, (ABIN5616556), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 10 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN10 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- TSPAN10 (Tetraspanin 10 (TSPAN10))
-
Andere Bezeichnung
- Tetraspanin 10
-
Hintergrund
- TSPAN10 belongs to the tetraspanin (TM4SF) family. It is a multi-pass membrane protein. The exact function of TSPAN10 remains unknown.
-
Molekulargewicht
- 37 kDa (MW of target protein)
Target
-