ESYT3 Antikörper (Extended Synaptotagmin-Like Protein 3)

Details for Product anti-ESYT3 Antibody No. ABIN635488
Antigen
Reaktivität
Human
21
21
20
4
2
2
2
1
1
1
Wirt
Kaninchen
21
Klonalität
Polyklonal
Konjugat
Dieser ESYT3 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
13
9
3
1
Optionen
Immunogen FAM62 C antibody was raised using a synthetic peptide corresponding to a region with amino acids EVFEFMVYEVPGQDLEVDLYDEDTDRDDFLGSLQICLGDVMTNRVVDEWF
Reinigung Affinity purified
Antigen
Andere Bezeichnung FAM62C (ESYT3 Antibody Abstract)
Hintergrund FAM62C belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. FAM62C may play a role as calcium-regulated intrinsic membrane protein.
Molekulargewicht 100 kDa (MW of target protein)
Applikations-hinweise WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

FAM62C Blocking Peptide, catalog no. 33R-2783, is also available for use as a blocking control in assays to test for specificity of this FAM62C antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM60 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Extended Synaptotagmin-Like Protein 3 (ESYT3) antibody (ABIN635488) FAM62C antibody used at 0.5 ug/ml to detect target protein.