ESYT3 Antikörper

Produktnummer ABIN635487

Der Kaninchen Polyklonal anti-ESYT3 Antikörper (ABIN635487) detektiert spezifisch ESYT3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Ratte, Human und Maus.

Kurzübersicht für ESYT3 Antikörper (ABIN635487)

Target: ESYT3 (Extended Synaptotagmin-Like Protein 3 (ESYT3))

Reaktivität: Ratte, Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ESYT3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ESYT3 Antikörper

Aufreinigung: Affinity purified

Immunogen: FAM62 C antibody was raised using a synthetic peptide corresponding to a region with amino acids RNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEWANK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM62C Blocking Peptide, (ABIN5613495), is also available for use as a blocking control in assays to test for specificity of this FAM62C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM60 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ESYT3

Target: ESYT3 (Extended Synaptotagmin-Like Protein 3 (ESYT3))

Andere Bezeichnung: FAM62C

Hintergrund: FAM62C belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. FAM62C may play a role as calcium-regulated intrinsic membrane protein.

Molekulargewicht: 100 kDa (MW of target protein)