ESYT3 Antikörper
Kurzübersicht für ESYT3 Antikörper (ABIN635487)
Target
Alle ESYT3 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Aufreinigung
- Affinity purified
-
Immunogen
- FAM62 C antibody was raised using a synthetic peptide corresponding to a region with amino acids RNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEWANK
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
FAM62C Blocking Peptide, (ABIN5613495), is also available for use as a blocking control in assays to test for specificity of this FAM62C antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM60 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
- Avoid repeated freeze/thaw cycles.
-
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- ESYT3 (Extended Synaptotagmin-Like Protein 3 (ESYT3))
-
Andere Bezeichnung
- FAM62C
-
Hintergrund
- FAM62C belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. FAM62C may play a role as calcium-regulated intrinsic membrane protein.
-
Molekulargewicht
- 100 kDa (MW of target protein)
Target
-