FAM134A Antikörper (N-Term)

Produktnummer ABIN635481

Produktdetails anti-FAM134A Antikörper

Target: FAM134A (Family with Sequence Similarity 134, Member A (FAM134A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM134A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM134 A antibody was raised against the N terminal of FAM134

Aufreinigung: Affinity purified

Immunogen: FAM134 A antibody was raised using the N terminal of FAM134 corresponding to a region with amino acids AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM134A Blocking Peptide, catalog no. 33R-1221, is also available for use as a blocking control in assays to test for specificity of this FAM134A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM134A

Target: FAM134A (Family with Sequence Similarity 134, Member A (FAM134A))

Andere Bezeichnung: FAM134A (FAM134A Produkte)

Synonyme: C2orf17 antikoerper, RGD1306844 antikoerper, reticulophagy regulator family member 2 antikoerper, RETREG2 antikoerper, Retreg2 antikoerper

Hintergrund: The function of FAM134 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 58 kDa (MW of target protein)