PRRG3 Antikörper (N-Term)

Produktnummer ABIN635480

Produktdetails anti-PRRG3 Antikörper

Target: PRRG3 (Proline Rich Gla (G-Carboxyglutamic Acid) 3 (Transmembrane) (PRRG3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRRG3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRRG3 antibody was raised against the N terminal of PRRG3

Aufreinigung: Affinity purified

Immunogen: PRRG3 antibody was raised using the N terminal of PRRG3 corresponding to a region with amino acids EEICSYEEVKEVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMYVVVPLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRRG3 Blocking Peptide, catalog no. 33R-2360, is also available for use as a blocking control in assays to test for specificity of this PRRG3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRRG3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRRG3

Target: PRRG3 (Proline Rich Gla (G-Carboxyglutamic Acid) 3 (Transmembrane) (PRRG3))

Andere Bezeichnung: PRRG3 (PRRG3 Produkte)

Synonyme: MGC84023 antikoerper, PRGP3 antikoerper, TMG3 antikoerper, Gm368 antikoerper, RGD1560309 antikoerper, proline rich and Gla domain 3 antikoerper, proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane) L homeolog antikoerper, proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane) antikoerper, PRRG3 antikoerper, prrg3.L antikoerper, Prrg3 antikoerper

Hintergrund: The function of PRRG3 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 26 kDa (MW of target protein)