TMEM38A Antikörper (N-Term)

Produktnummer ABIN635479

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TMEM38A in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für TMEM38A Antikörper (N-Term) (ABIN635479)

Target: TMEM38A (Transmembrane Protein 38A (TMEM38A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM38A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM38A Antikörper

Bindungsspezifität: N-Term

Spezifität: TMEM38 A antibody was raised against the N terminal of TMEM38

Aufreinigung: Affinity purified

Immunogen: TMEM38 A antibody was raised using the N terminal of TMEM38 corresponding to a region with amino acids GEPLIDYFSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM38A Blocking Peptide, catalog no. 33R-3241, is also available for use as a blocking control in assays to test for specificity of this TMEM38A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM38A

Target: TMEM38A (Transmembrane Protein 38A (TMEM38A))

Andere Bezeichnung: TMEM38A

Hintergrund: TMEM38A is a monovalent cation channel required for maintenance of rapid intracellular calcium release. It may act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.

Molekulargewicht: 33 kDa (MW of target protein)