Tenomodulin (TNMD) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635478
Antigen
Epitop
N-Term
15
8
7
7
7
4
3
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
52
30
21
5
4
4
4
4
2
2
2
2
1
Wirt
Kaninchen
50
1
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
5
4
4
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Applikation
Western Blotting (WB)
31
22
13
13
7
2
2
2
1
1
1
1
Optionen
Immunogen Tenomodulin antibody was raised using the N terminal of TNMD corresponding to a region with amino acids KKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIK
Spezifität Tenomodulin antibody was raised against the N terminal of TNMD
Reinigung Affinity purified
Antigen
Andere Bezeichnung Tenomodulin (TNMD Antibody Abstract)
Hintergrund TNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor.
Molekulargewicht 37 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Tenomodulin Blocking Peptide, catalog no. 33R-4477, is also available for use as a blocking control in assays to test for specificity of this Tenomodulin antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNMD antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Tenomodulin (TNMD) (N-Term) antibody (ABIN635478) Tenomodulin antibody used at 1 ug/ml to detect target protein.