CATSPERG Antikörper (C-Term)

Produktnummer ABIN635477

Produktdetails anti-CATSPERG Antikörper

Target: CATSPERG (Cation Channel, Sperm-Associated, gamma (CATSPERG))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CATSPERG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C19 ORF15 antibody was raised against the C terminal Of C19 rf15

Aufreinigung: Affinity purified

Immunogen: C19 ORF15 antibody was raised using the C terminal Of C19 rf15 corresponding to a region with amino acids FFLIQDLVTGDSGSFQGSYVLLVVGGGPTLDSLKDYSEDEIYRFNSPLDK

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C19ORF15 Blocking Peptide, catalog no. 33R-2894, is also available for use as a blocking control in assays to test for specificity of this C19ORF15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CATSPERG

Target: CATSPERG (Cation Channel, Sperm-Associated, gamma (CATSPERG))

Andere Bezeichnung: C19ORF15 (CATSPERG Produkte)

Synonyme: C19orf15 antikoerper, cation channel sperm associated auxiliary subunit gamma antikoerper, CATSPERG antikoerper

Hintergrund: C19orf15 is a single-pass type I membrane protein. The exact function of C19orf15 remains unknown.

Molekulargewicht: 92 kDa (MW of target protein)