CACHD1 Antikörper (N-Term)

Produktnummer ABIN635475

Dieses Anti-CACHD1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CACHD1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für CACHD1 Antikörper (N-Term) (ABIN635475)

Target: CACHD1 (Cache Domain Containing 1 (CACHD1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CACHD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CACHD1 Antikörper

Bindungsspezifität: N-Term

Spezifität: CACHD1 antibody was raised against the N terminal of CACHD1

Aufreinigung: Affinity purified

Immunogen: CACHD1 antibody was raised using the N terminal of CACHD1 corresponding to a region with amino acids HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CACHD1 Blocking Peptide, (ABIN939147), is also available for use as a blocking control in assays to test for specificity of this CACHD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACHD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CACHD1

Target: CACHD1 (Cache Domain Containing 1 (CACHD1))

Andere Bezeichnung: CACHD1

Hintergrund: CACHD1 belongs to the calcium channel subunit alpha-2/delta family. It contains 2 cache domains and 1 VWFA domain. CACHD1 may regulate voltage-dependent calcium channels.

Molekulargewicht: 137 kDa (MW of target protein)