Extended Synaptotagmin 2 Antikörper

Details zu Produkt Nr. ABIN635474
Antigen
Reaktivität
Human, Maus
30
18
17
2
2
2
1
1
1
1
Wirt
Kaninchen
24
6
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
14
13
8
7
2
1
1
1
Optionen
Immunogen FAM62 B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS
Reinigung Affinity purified
Antigen
Andere Bezeichnung FAM62B
Hintergrund FAM62B may play a role as calcium-regulated intrinsic membrane protein.
Molekulargewicht 99 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

FAM62B Blocking Peptide, catalog no. 33R-6875, is also available for use as a blocking control in assays to test for specificity of this FAM62B antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM60 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Extended Synaptotagmin 2 antibody (ABIN635474) FAM62B antibody used at 1 ug/ml to detect target protein.