FAM62B Antikörper

Produktnummer ABIN635474

Produktdetails anti-FAM62B Antikörper

Target: FAM62B (ESYT2) (Extended Synaptotagmin 2 (ESYT2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM62B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: FAM62 B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM62B Blocking Peptide, catalog no. 33R-6875, is also available for use as a blocking control in assays to test for specificity of this FAM62B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM60 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM62B

Target: FAM62B (ESYT2) (Extended Synaptotagmin 2 (ESYT2))

Andere Bezeichnung: FAM62B (ESYT2 Produkte)

Synonyme: CHR2SYT antikoerper, E-Syt2 antikoerper, FAM62B antikoerper, 2410017M09Rik antikoerper, 4921504I16Rik antikoerper, D12Ertd551e antikoerper, Fam62b antikoerper, extended synaptotagmin 2 antikoerper, extended synaptotagmin-like protein 2 antikoerper, ESYT2 antikoerper, Esyt2 antikoerper

Hintergrund: FAM62B may play a role as calcium-regulated intrinsic membrane protein.

Molekulargewicht: 99 kDa (MW of target protein)