TMCC3 Antikörper (N-Term)

Produktnummer ABIN635473

Produktdetails anti-TMCC3 Antikörper

Target: TMCC3 (Transmembrane and Coiled-Coil Domain Family 3 (TMCC3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMCC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMCC3 antibody was raised against the N terminal of TMCC3

Aufreinigung: Affinity purified

Immunogen: TMCC3 antibody was raised using the N terminal of TMCC3 corresponding to a region with amino acids MPGSDTALTVDRTYSDPGRHHRCKSRVERHDMNTLSLPLNIRRGGSDTNL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMCC3 Blocking Peptide, catalog no. 33R-6283, is also available for use as a blocking control in assays to test for specificity of this TMCC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMCC3

Target: TMCC3 (Transmembrane and Coiled-Coil Domain Family 3 (TMCC3))

Andere Bezeichnung: TMCC3 (TMCC3 Produkte)

Synonyme: wu:fb81d10 antikoerper, wu:fb83h01 antikoerper, wu:fk68a09 antikoerper, wu:fl22e07 antikoerper, si:dkey-183c16.4 antikoerper, DKFZp469H0211 antikoerper, AW488095 antikoerper, C630016B22Rik antikoerper, C88213 antikoerper, Tmcc1 antikoerper, RGD1307241 antikoerper, transmembrane and coiled-coil domain family 3 antikoerper, transmembrane and coiled coil domains 3 antikoerper, tmcc3 antikoerper, TMCC3 antikoerper, Tmcc3 antikoerper

Hintergrund: The function of TMCC3 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 54 kDa (MW of target protein)