TMCC3 Antikörper (N-Term)

Produktnummer ABIN635473

This anti-TMCC3 antibody (ABIN635473) is a Rabbit Polyclonal antibody detecting TMCC3 in WB. Suitable for Human, Mouse, Rat.

Kurzübersicht für TMCC3 Antikörper (N-Term) (ABIN635473)

Target: TMCC3 (Transmembrane and Coiled-Coil Domain Family 3 (TMCC3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMCC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMCC3 Antikörper

Bindungsspezifität: N-Term

Spezifität: TMCC3 antibody was raised against the N terminal of TMCC3

Aufreinigung: Affinity purified

Immunogen: TMCC3 antibody was raised using the N terminal of TMCC3 corresponding to a region with amino acids MPGSDTALTVDRTYSDPGRHHRCKSRVERHDMNTLSLPLNIRRGGSDTNL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMCC3 Blocking Peptide, catalog no. 33R-6283, is also available for use as a blocking control in assays to test for specificity of this TMCC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMCC3

Target: TMCC3 (Transmembrane and Coiled-Coil Domain Family 3 (TMCC3))

Andere Bezeichnung: TMCC3

Hintergrund: The function of TMCC3 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 54 kDa (MW of target protein)