GALNTL1 Antikörper (N-Term)

Produktnummer ABIN635472

Produktdetails anti-GALNTL1 Antikörper

Target: GALNTL1 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase-Like 1 (GALNTL1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GALNTL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GALNTL1 antibody was raised against the N terminal Of Galntl1

Aufreinigung: Affinity purified

Immunogen: GALNTL1 antibody was raised using the N terminal Of Galntl1 corresponding to a region with amino acids LSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYSSDLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GALNTL1 Blocking Peptide, catalog no. 33R-5407, is also available for use as a blocking control in assays to test for specificity of this GALNTL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNTL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GALNTL1

Target: GALNTL1 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase-Like 1 (GALNTL1))

Andere Bezeichnung: GALNTL1 (GALNTL1 Produkte)

Synonyme: galntl1 antikoerper, xGalntl-1 antikoerper, GALNACT16 antikoerper, GALNTL1 antikoerper, GalNAc-T16 antikoerper, 5730405L21Rik antikoerper, AI415388 antikoerper, Galntl1 antikoerper, mpp-GalNAc-T16 antikoerper, polypeptide N-acetylgalactosaminyltransferase 16 antikoerper, UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 16 antikoerper, polypeptide N-acetylgalactosaminyltransferase 16 L homeolog antikoerper, GALNT16 antikoerper, galnt16 antikoerper, galnt16.L antikoerper, Galnt16 antikoerper

Hintergrund: GALNTL1 belongs to the glycosyltransferase 2 family, GalNAc-T subfamily. It contains 1 ricin B-type lectin domain. GALNTL1 may catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.

Molekulargewicht: 63 kDa (MW of target protein)