Junctophilin 1 Antikörper (C-Term)

Produktnummer ABIN635471

Der Kaninchen Polyklonal anti-Junctophilin 1 Antikörper wird verwendet zum Nachweis von Junctophilin 1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für Junctophilin 1 Antikörper (C-Term) (ABIN635471)

Target: Junctophilin 1 (JPH1)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Junctophilin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Junctophilin 1 Antikörper

Bindungsspezifität: C-Term

Spezifität: Junctophilin 1 antibody was raised against the C terminal of JPH1

Aufreinigung: Affinity purified

Immunogen: Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids SNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Junctophilin 1 Blocking Peptide, (ABIN5614247), is also available for use as a blocking control in assays to test for specificity of this Junctophilin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JPH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Junctophilin 1

Target: Junctophilin 1 (JPH1)

Andere Bezeichnung: Junctophilin 1

Hintergrund: Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH1 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane.

Molekulargewicht: 72 kDa (MW of target protein)