APMAP Antikörper (N-Term)

Produktnummer ABIN635470

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch APMAP in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für APMAP Antikörper (N-Term) (ABIN635470)

Target: APMAP (Adipocyte Plasma Membrane Associated Protein (APMAP))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APMAP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-APMAP Antikörper

Bindungsspezifität: N-Term

Spezifität: C20 ORF3 antibody was raised against the N terminal Of C20 rf3

Aufreinigung: Affinity purified

Immunogen: C20 ORF3 antibody was raised using the N terminal Of C20 rf3 corresponding to a region with amino acids EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C20ORF3 Blocking Peptide, (ABIN938026), is also available for use as a blocking control in assays to test for specificity of this C20ORF3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APMAP

Target: APMAP (Adipocyte Plasma Membrane Associated Protein (APMAP))

Andere Bezeichnung: C20ORF3

Hintergrund: C20orf3 exhibits strong arylesterase activity with beta-naphthyl acetate and phenyl acetate. It may play a role in adipocyte differentiation.

Molekulargewicht: 46 kDa (MW of target protein)