DOLPP1 Antikörper (N-Term)

Produktnummer ABIN635468

Der Kaninchen Polyklonal anti-DOLPP1 Antikörper wird verwendet zum Nachweis von DOLPP1 in Proben von Maus, Ratte und Human. Er wurde validiert für WB.

Kurzübersicht für DOLPP1 Antikörper (N-Term) (ABIN635468)

Target: DOLPP1 (Dolichyl Pyrophosphate Phosphatase 1 (DOLPP1))

Reaktivität: Maus, Ratte, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DOLPP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DOLPP1 Antikörper

Bindungsspezifität: N-Term

Spezifität: DOLPP1 antibody was raised against the N terminal of DOLPP1

Aufreinigung: Affinity purified

Immunogen: DOLPP1 antibody was raised using the N terminal of DOLPP1 corresponding to a region with amino acids AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DOLPP1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this DOLPP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOLPP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DOLPP1

Target: DOLPP1 (Dolichyl Pyrophosphate Phosphatase 1 (DOLPP1))

Andere Bezeichnung: DOLPP1

Hintergrund: DOLPP1 is a multi-pass membrane proteinBy similarity. It belongs to the dolichyldiphosphatase family. It is required for efficient N-glycosylation and is necessary for maintaining optimal levels of dolichol-linked oligosaccharides. DOLPP1 hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. It does not act on phosphatidate.

Molekulargewicht: 27 kDa (MW of target protein)