TMEM63C Antikörper (Middle Region)

Produktnummer ABIN635467

Produktdetails anti-TMEM63C Antikörper

Target: TMEM63C (Transmembrane Protein 63C (TMEM63C))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM63C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM63 C antibody was raised against the middle region of TMEM63

Aufreinigung: Affinity purified

Immunogen: TMEM63 C antibody was raised using the middle region of TMEM63 corresponding to a region with amino acids EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM63C Blocking Peptide, catalog no. 33R-2348, is also available for use as a blocking control in assays to test for specificity of this TMEM63C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM63C

Target: TMEM63C (Transmembrane Protein 63C (TMEM63C))

Andere Bezeichnung: TMEM63C (TMEM63C Produkte)

Synonyme: DKFZp468A1211 antikoerper, C14orf171 antikoerper, 4932420N09 antikoerper, 9330187M14Rik antikoerper, RGD1310207 antikoerper, transmembrane protein 63C antikoerper, transmembrane protein 63c antikoerper, TMEM63C antikoerper, tmem63c antikoerper, Tmem63c antikoerper

Hintergrund: The function of TMEM63C protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 93 kDa (MW of target protein)