TMCO1 Antikörper (C-Term)

Produktnummer ABIN635466

Produktdetails anti-TMCO1 Antikörper

Target: TMCO1 (Transmembrane and Coiled-Coil Domains 1 (TMCO1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMCO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMCO1 antibody was raised against the C terminal of TMCO1

Aufreinigung: Affinity purified

Immunogen: TMCO1 antibody was raised using the C terminal of TMCO1 corresponding to a region with amino acids CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMCO1 Blocking Peptide, catalog no. 33R-1807, is also available for use as a blocking control in assays to test for specificity of this TMCO1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCO1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMCO1

Target: TMCO1 (Transmembrane and Coiled-Coil Domains 1 (TMCO1))

Andere Bezeichnung: TMCO1 (TMCO1 Produkte)

Synonyme: DKFZp459A2226 antikoerper, sb:cb729 antikoerper, zgc:110322 antikoerper, zgc:92740 antikoerper, HP10122 antikoerper, PCIA3 antikoerper, PNAS-136 antikoerper, RP11-466F5.7 antikoerper, TMCC4 antikoerper, 1190006A08Rik antikoerper, 4930403O06Rik antikoerper, AA109065 antikoerper, AU022572 antikoerper, ESTM39 antikoerper, transmembrane and coiled-coil domains 1 antikoerper, transmembrane and coiled-coil domains 1 S homeolog antikoerper, TMCO1 antikoerper, tmco1 antikoerper, tmco1.S antikoerper, Tmco1 antikoerper

Hintergrund: TMCO1 belongs to the TMCO1 family. The exact function of TMCO1 remains unknown.

Molekulargewicht: 21 kDa (MW of target protein)