Chromosome 7 Open Reading Frame 42 (C7orf42) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635459
Antigen
Epitop
N-Term
2
Reaktivität
Human
25
16
16
1
1
1
1
1
1
1
Wirt
Kaninchen
25
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
13
7
4
1
1
1
Optionen
Immunogen C7 ORF42 antibody was raised using the N terminal Of C7 rf42 corresponding to a region with amino acids FSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEM
Spezifität C7 ORF42 antibody was raised against the N terminal Of C7 rf42
Reinigung Affinity purified
Antigen
Andere Bezeichnung C7ORF42
Hintergrund The function of C7orf42 protein has not been widely studied, and is yet to be fully elucidated.
Molekulargewicht 35 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

C7ORF42 Blocking Peptide, catalog no. 33R-3065, is also available for use as a blocking control in assays to test for specificity of this C7ORF42 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF42 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Chromosome 7 Open Reading Frame 42 (C7orf42) (N-Term) antibody (ABIN635459) C7ORF42 antibody used at 1 ug/ml to detect target protein.