C7orf42 Antikörper (N-Term)

Produktnummer ABIN635459

Der Kaninchen Polyklonal Anti-C7orf42-Antikörper wurde für WB validiert. Er ist geeignet, C7orf42 in Proben von Human zu detektieren.

Kurzübersicht für C7orf42 Antikörper (N-Term) (ABIN635459)

Target: C7orf42 (Chromosome 7 Open Reading Frame 42 (C7orf42))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C7orf42 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C7orf42 Antikörper

Bindungsspezifität: N-Term

Spezifität: C7 ORF42 antibody was raised against the N terminal Of C7 rf42

Aufreinigung: Affinity purified

Immunogen: C7 ORF42 antibody was raised using the N terminal Of C7 rf42 corresponding to a region with amino acids FSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C7ORF42 Blocking Peptide, catalog no. 33R-3065, is also available for use as a blocking control in assays to test for specificity of this C7ORF42 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF42 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C7orf42

Target: C7orf42 (Chromosome 7 Open Reading Frame 42 (C7orf42))

Andere Bezeichnung: C7ORF42

Hintergrund: The function of C7orf42 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 35 kDa (MW of target protein)