SUSD4 Antikörper (Sushi Domain Containing 4) (Middle Region)

Details for Product anti-SUSD4 Antibody No. ABIN635458
Antigen
Epitop
Middle Region
4
3
2
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
13
4
4
3
3
3
2
2
1
1
1
1
1
Wirt
Kaninchen
11
2
Klonalität
Polyklonal
Konjugat
Dieser SUSD4 Antikörper ist unkonjugiert
1
1
1
Applikation
Western Blotting (WB)
9
6
2
Optionen
Immunogen SUSD4 antibody was raised using the middle region of SUSD4 corresponding to a region with amino acids HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV
Spezifität SUSD4 antibody was raised against the middle region of SUSD4
Reinigung Affinity purified
Antigen
Andere Bezeichnung SUSD4
Hintergrund SUSD4 contains 4 Sushi (CCP/SCR) domains. It is a single-pass type I membrane protein. The function of the SUSD4 protein remains unknown.
Molekulargewicht 54 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SUSD4 Blocking Peptide, catalog no. 33R-3734, is also available for use as a blocking control in assays to test for specificity of this SUSD4 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUSD4 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Sushi Domain Containing 4 (SUSD4) (Middle Region) antibody (ABIN635458) SUSD4 antibody used at 1 ug/ml to detect target protein.