SUSD4 Antikörper (Middle Region)

Produktnummer ABIN635458

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SUSD4 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für SUSD4 Antikörper (Middle Region) (ABIN635458)

Target: SUSD4 (Sushi Domain Containing 4 (SUSD4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SUSD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SUSD4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SUSD4 antibody was raised against the middle region of SUSD4

Aufreinigung: Affinity purified

Immunogen: SUSD4 antibody was raised using the middle region of SUSD4 corresponding to a region with amino acids HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SUSD4 Blocking Peptide, (ABIN939120), is also available for use as a blocking control in assays to test for specificity of this SUSD4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUSD4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SUSD4

Target: SUSD4 (Sushi Domain Containing 4 (SUSD4))

Andere Bezeichnung: SUSD4

Hintergrund: SUSD4 contains 4 Sushi (CCP/SCR) domains. It is a single-pass type I membrane protein. The function of the SUSD4 protein remains unknown.

Molekulargewicht: 54 kDa (MW of target protein)