HLC8 Antikörper (N-Term)

Produktnummer ABIN635456

Der Kaninchen Polyklonal Anti-HLC8-Antikörper wurde für WB validiert. Er ist geeignet, HLC8 in Proben von Human zu detektieren.

Kurzübersicht für HLC8 Antikörper (N-Term) (ABIN635456)

Target: HLC8 (C17orf80) (Chromosome 17 Open Reading Frame 80 (C17orf80))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HLC8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HLC8 Antikörper

Bindungsspezifität: N-Term

Spezifität: C17 ORF80 antibody was raised against the N terminal Of C17 rf80

Aufreinigung: Affinity purified

Immunogen: C17 ORF80 antibody was raised using the N terminal Of C17 rf80 corresponding to a region with amino acids MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTIPTDQKVYQSKPATLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C17ORF80 Blocking Peptide, (ABIN5612429), is also available for use as a blocking control in assays to test for specificity of this C17ORF80 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF80 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HLC8

Target: HLC8 (C17orf80) (Chromosome 17 Open Reading Frame 80 (C17orf80))

Andere Bezeichnung: C17ORF80

Hintergrund: The function of C17orf80 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 67 kDa (MW of target protein)