FAM70A Antikörper (N-Term)

Produktnummer ABIN635455

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch FAM70A in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für FAM70A Antikörper (N-Term) (ABIN635455)

Target: FAM70A (Family with Sequence Similarity 70, Member A (FAM70A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM70A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM70A Antikörper

Bindungsspezifität: N-Term

Spezifität: FAM70 A antibody was raised against the N terminal of FAM70

Aufreinigung: Affinity purified

Immunogen: FAM70 A antibody was raised using the N terminal of FAM70 corresponding to a region with amino acids IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM70A Blocking Peptide, (ABIN939581), is also available for use as a blocking control in assays to test for specificity of this FAM70A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM70A

Target: FAM70A (Family with Sequence Similarity 70, Member A (FAM70A))

Andere Bezeichnung: FAM70A

Hintergrund: The function of FAM70A protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 38 kDa (MW of target protein)