TMEM127 Antikörper (Middle Region)

Produktnummer ABIN635454

Dieses Anti-TMEM127-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TMEM127 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für TMEM127 Antikörper (Middle Region) (ABIN635454)

Target: TMEM127 (Transmembrane Protein 127 (TMEM127))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM127 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM127 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TMEM127 antibody was raised against the middle region of TMEM127

Aufreinigung: Affinity purified

Immunogen: TMEM127 antibody was raised using the middle region of TMEM127 corresponding to a region with amino acids AFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM127 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TMEM127 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM127 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM127

Target: TMEM127 (Transmembrane Protein 127 (TMEM127))

Andere Bezeichnung: TMEM127

Hintergrund: TMEM127 is a multi-pass membrane protein. The exact function of TMEM127 remains unknown.

Molekulargewicht: 26 kDa (MW of target protein)