RHBDL2 Antikörper
-
- Target Alle RHBDL2 Antikörper anzeigen
- RHBDL2 (Rhomboid, Veinlet-Like 2 (RHBDL2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RHBDL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RHBDL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT
- Top Product
- Discover our top product RHBDL2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RHBDL2 Blocking Peptide, catalog no. 33R-4732, is also available for use as a blocking control in assays to test for specificity of this RHBDL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHBDL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RHBDL2 (Rhomboid, Veinlet-Like 2 (RHBDL2))
- Andere Bezeichnung
- RHBDL2 (RHBDL2 Produkte)
- Synonyme
- RRP2 antikoerper, 9130416B15 antikoerper, rhomboid like 2 antikoerper, rhomboid, veinlet-like 2 (Drosophila) antikoerper, RHBDL2 antikoerper, Rhbdl2 antikoerper
- Hintergrund
- RHBDL2 is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. RHBDL2 is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3.
- Molekulargewicht
- 34 kDa (MW of target protein)
-