RHBDL2 Antikörper

Produktnummer ABIN635453

Der Kaninchen Polyklonal Anti-RHBDL2-Antikörper wurde für WB validiert. Er ist geeignet, RHBDL2 in Proben von Human zu detektieren.

Kurzübersicht für RHBDL2 Antikörper (ABIN635453)

Target: RHBDL2 (Rhomboid, Veinlet-Like 2 (RHBDL2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHBDL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RHBDL2 Antikörper

Aufreinigung: Affinity purified

Immunogen: RHBDL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHBDL2 Blocking Peptide, (ABIN940118), is also available for use as a blocking control in assays to test for specificity of this RHBDL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHBDL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHBDL2

Target: RHBDL2 (Rhomboid, Veinlet-Like 2 (RHBDL2))

Andere Bezeichnung: RHBDL2

Hintergrund: RHBDL2 is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. RHBDL2 is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3.

Molekulargewicht: 34 kDa (MW of target protein)