TMEM161A Antikörper (Middle Region)

Produktnummer ABIN635452

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TMEM161A in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für TMEM161A Antikörper (Middle Region) (ABIN635452)

Target: TMEM161A (Transmembrane Protein 161A (TMEM161A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM161A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM161A Antikörper

Bindungsspezifität: Middle Region

Spezifität: TMEM161 A antibody was raised against the middle region of TMEM161

Aufreinigung: Affinity purified

Immunogen: TMEM161 A antibody was raised using the middle region of TMEM161 corresponding to a region with amino acids LLAMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKLAIR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM161A Blocking Peptide, (ABIN940503), is also available for use as a blocking control in assays to test for specificity of this TMEM161A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM160 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM161A

Target: TMEM161A (Transmembrane Protein 161A (TMEM161A))

Andere Bezeichnung: TMEM161A

Hintergrund: TMEM161A may be involved in the development of dendritic cells.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus