TMEM69 Antikörper (Transmembrane Protein 69) (Middle Region)

Details for Product anti-TMEM69 Antibody No. ABIN635451
Antigen
Epitop
Middle Region
1
1
Reaktivität
Human
4
2
2
2
1
1
1
1
1
Wirt
Kaninchen
4
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
4
3
2
1
Optionen
Immunogen TMEM69 antibody was raised using the middle region of TMEM69 corresponding to a region with amino acids AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE
Spezifität TMEM69 antibody was raised against the middle region of TMEM69
Reinigung Affinity purified
Antigen
Andere Bezeichnung TMEM69
Hintergrund The function of TMEM69 protein is not widely studied, and is yet to be elucidated fully.
Molekulargewicht 27 kDa (MW of target protein)
Applikations-hinweise WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

TMEM69 Blocking Peptide, catalog no. 33R-1628, is also available for use as a blocking control in assays to test for specificity of this TMEM69 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM69 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Transmembrane Protein 69 (TMEM69) (Middle Region) antibody (ABIN635451) TMEM69 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to ...
Image no. 2 for anti-Transmembrane Protein 69 (TMEM69) (Middle Region) antibody (ABIN635451) TMEM69 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Ma...
Image no. 3 for anti-Transmembrane Protein 69 (TMEM69) (Middle Region) antibody (ABIN635451) TMEM69 antibody used at 0.5 ug/ml to detect target protein.