Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

Chromosome 19 Open Reading Frame 56 (C19orf56) (N-Term) Antikörper Primary Antibody

C19orf56 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN635449
$647.32
Zzgl. Versandkosten $45.00
50 μg
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 9 bis 11 Werktagen
  • Target
    Chromosome 19 Open Reading Frame 56 (C19orf56)
    Bindungsspezifität
    N-Term
    Reaktivität
    Human, Maus, Ratte
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Wirt
    Kaninchen
    Klonalität
    Polyklonal
    Applikation
    Western Blotting (WB)
    Spezifität
    C19 ORF56 antibody was raised against the N terminal Of C19 rf56
    Aufreinigung
    Affinity purified
    Immunogen
    C19 ORF56 antibody was raised using the N terminal Of C19 rf56 corresponding to a region with amino acids STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML
  • Applikationshinweise
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Kommentare

    C19ORF56 Blocking Peptide, catalog no. 33R-8878, is also available for use as a blocking control in assays to test for specificity of this C19ORF56 antibody

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF56 antibody in PBS
    Konzentration
    Lot specific
    Buffer
    PBS
    Handhabung
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Lagerung
    4 °C
    Informationen zur Lagerung
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Chromosome 19 Open Reading Frame 56 (C19orf56)
    Andere Bezeichnung
    C19ORF56 ()
    Synonyme
    MGC81480, C19orf56, PTD008, C7H19orf56, WD repeat domain 83 opposite strand L homeolog, WD repeat domain 83 opposite strand, wdr83os.L, WDR83OS, wdr83os
    Hintergrund
    The function of C19orf56 protein has not been widely studied, and is yet to be fully elucidated.
    Molekulargewicht
    12 kDa (MW of target protein)
Sie sind hier:
help Kundenservice