C19orf56 Antikörper (N-Term)

Produktnummer ABIN635449

Produktdetails anti-C19orf56 Antikörper

Target: C19orf56 (Chromosome 19 Open Reading Frame 56 (C19orf56))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C19orf56 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C19 ORF56 antibody was raised against the N terminal Of C19 rf56

Aufreinigung: Affinity purified

Immunogen: C19 ORF56 antibody was raised using the N terminal Of C19 rf56 corresponding to a region with amino acids STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C19ORF56 Blocking Peptide, catalog no. 33R-8878, is also available for use as a blocking control in assays to test for specificity of this C19ORF56 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF56 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C19orf56

Target: C19orf56 (Chromosome 19 Open Reading Frame 56 (C19orf56))

Andere Bezeichnung: C19ORF56 (C19orf56 Produkte)

Synonyme: MGC81480 antikoerper, C19orf56 antikoerper, PTD008 antikoerper, C7H19orf56 antikoerper, WD repeat domain 83 opposite strand L homeolog antikoerper, WD repeat domain 83 opposite strand antikoerper, wdr83os.L antikoerper, WDR83OS antikoerper, wdr83os antikoerper

Hintergrund: The function of C19orf56 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 12 kDa (MW of target protein)