Chromosome 19 Open Reading Frame 56 (C19orf56) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635449
Antigen
Epitop
N-Term
2
Reaktivität
Human, Maus, Ratte (Rattus)
2
2
2
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
2
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
2
Optionen
Immunogen C19 ORF56 antibody was raised using the N terminal Of C19 rf56 corresponding to a region with amino acids STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML
Spezifität C19 ORF56 antibody was raised against the N terminal Of C19 rf56
Reinigung Affinity purified
Antigen
Andere Bezeichnung C19ORF56
Hintergrund The function of C19orf56 protein has not been widely studied, and is yet to be fully elucidated.
Molekulargewicht 12 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

C19ORF56 Blocking Peptide, catalog no. 33R-8878, is also available for use as a blocking control in assays to test for specificity of this C19ORF56 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF56 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Chromosome 19 Open Reading Frame 56 (C19orf56) (N-Term) antibody (ABIN635449) C19ORF56 antibody used at 1 ug/ml to detect target protein.