PTDSS1 Antikörper (N-Term)

Produktnummer ABIN635446

Produktdetails anti-PTDSS1 Antikörper

Target: PTDSS1 (phosphatidylserine Synthase 1 (PTDSS1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTDSS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PTDSS1 antibody was raised against the N terminal of PTDSS1

Aufreinigung: Affinity purified

Immunogen: PTDSS1 antibody was raised using the N terminal of PTDSS1 corresponding to a region with amino acids MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTDSS1 Blocking Peptide, catalog no. 33R-5738, is also available for use as a blocking control in assays to test for specificity of this PTDSS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTDSS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTDSS1

Target: PTDSS1 (phosphatidylserine Synthase 1 (PTDSS1))

Andere Bezeichnung: PTDSS1 (PTDSS1 Produkte)

Synonyme: PSS-1 antikoerper, zgc:55906 antikoerper, PSS1 antikoerper, PSSA antikoerper, AU044268 antikoerper, AW539008 antikoerper, mKIAA0024 antikoerper, phosphatidylserine synthase 1a antikoerper, phosphatidylserine synthase 1 antikoerper, ptdss1a antikoerper, PTDSS1 antikoerper, Ptdss1 antikoerper

Hintergrund: PTDSS1 is a multi-pass membrane protein. It belongs to the phosphatidyl serine synthase family. PTDSS1 catalyzes a base-exchange reaction in which the polar head group of phosphatidylcholine is replaced by L-serine.

Molekulargewicht: 55 kDa (MW of target protein)