PTDSS1 Antikörper (phosphatidylserine Synthase 1) (N-Term)

Details for Product anti-PTDSS1 Antibody No. ABIN635446
Antigen
Epitop
N-Term
9
9
7
4
3
2
Reaktivität
Human
48
2
2
2
2
1
1
1
1
1
1
Wirt
Kaninchen
46
2
Klonalität
Polyklonal
Konjugat
Dieser PTDSS1 Antikörper ist unkonjugiert
7
6
5
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
40
31
12
1
1
1
Optionen
Immunogen PTDSS1 antibody was raised using the N terminal of PTDSS1 corresponding to a region with amino acids MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI
Spezifität PTDSS1 antibody was raised against the N terminal of PTDSS1
Reinigung Affinity purified
Antigen
Andere Bezeichnung PTDSS1 (PTDSS1 Antibody Abstract)
Hintergrund PTDSS1 is a multi-pass membrane protein. It belongs to the phosphatidyl serine synthase family. PTDSS1 catalyzes a base-exchange reaction in which the polar head group of phosphatidylcholine is replaced by L-serine.
Molekulargewicht 55 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PTDSS1 Blocking Peptide, catalog no. 33R-5738, is also available for use as a blocking control in assays to test for specificity of this PTDSS1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTDSS1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-phosphatidylserine Synthase 1 (PTDSS1) (N-Term) antibody (ABIN635446) PTDSS1 antibody used at 1 ug/ml to detect target protein.