TM9SF4 Antikörper (N-Term)

Produktnummer ABIN635445

Produktdetails anti-TM9SF4 Antikörper

Target: TM9SF4 (Transmembrane 9 Superfamily Protein Member 4 (TM9SF4))

Bindungsspezifität: N-Term

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TM9SF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TM9 SF4 antibody was raised against the N terminal of TM9 F4

Aufreinigung: Affinity purified

Immunogen: TM9 SF4 antibody was raised using the N terminal of TM9 F4 corresponding to a region with amino acids HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TM9SF4 Blocking Peptide, catalog no. 33R-3826, is also available for use as a blocking control in assays to test for specificity of this TM9SF4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TM9SF4

Target: TM9SF4 (Transmembrane 9 Superfamily Protein Member 4 (TM9SF4))

Andere Bezeichnung: TM9SF4 (TM9SF4 Produkte)

Hintergrund: TM9SF4 is required for phagocytosis in S2 cells.

Molekulargewicht: 72 kDa (MW of target protein)